Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP9 Peptide - middle region

RANBP9 Peptide - middle region

Product Specifications

Product Name Alternative

BPM-L, BPM90, RANBPM, RanBP7

UniProt

Q6VN20

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005484.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab31 Rat Pre-designed siRNA Set A
HY-RS25519 1 Set

Rab31 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human FcεRIα (FcεRIα) ELISA Kit
YP-W15855-01 48 Tests

Human FcεRIα (FcεRIα) ELISA Kit

Sign In for Pricing
View Details
Human FcεRIα (FcεRIα) ELISA Kit
YP-W15855-02 96 Tests

Human FcεRIα (FcεRIα) ELISA Kit

Sign In for Pricing
View Details
Ephrin A1 (EFNA1) Monkey ELISA Kit
D1133 96 Tests

Ephrin A1 (EFNA1) Monkey ELISA Kit

Sign In for Pricing
View Details
MRO AAV siRNA Pooled Vector
30425161 1.0 µg

MRO AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SARS2, ID (Seryl-tRNA Synthetase, Mitochondrial, Seryl-tRNA (Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SerRSmt, SARSM) (PE) discontinued
S1009-35A-PE 200 µL

SARS2, ID (Seryl-tRNA Synthetase, Mitochondrial, Seryl-tRNA (Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SerRSmt, SARSM) (PE) discontinued

Sign In for Pricing
View Details