Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHMT2 Peptide - C-terminal region

BHMT2 Peptide - C-terminal region

Product Specifications

UniProt

Q93088

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171476.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Unc5cl 3'UTR Luciferase Stable Cell Line
TU121593 1.0 mL

Unc5cl 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
THEM6 siRNA (Mouse)
CRN2296-01 15 nmol

THEM6 siRNA (Mouse)

Sign In for Pricing
View Details
THEM6 siRNA (Mouse)
CRN2296-02 30 nmol

THEM6 siRNA (Mouse)

Sign In for Pricing
View Details
H-Ala-Pro-OMe · HCl
G-1365.1000 1.0g

H-Ala-Pro-OMe · HCl

Sign In for Pricing
View Details
HRF Rabbit Polyclonal Antibody
E28PT2226 100 µL

HRF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGF-16 Polyclonal Antibody
JOT-AP03205-01 20 µL

FGF-16 Polyclonal Antibody

Sign In for Pricing
View Details