Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHMT2 Peptide - C-terminal region

BHMT2 Peptide - C-terminal region

Product Specifications

UniProt

Q93088

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171476.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Otud5 Pre-designed siRNA Set A
SI209925A 1 Each

Rat Otud5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PTCHD3 Human shRNA Lentiviral Particle (Locus ID 374308)
TL310084V 500 µL Each

PTCHD3 Human shRNA Lentiviral Particle (Locus ID 374308)

Sign In for Pricing
View Details
Anti-Plectin Antibody Picoband® Fluoro550 Conjugated
PB9430-Fluoro550 100 µg/Vial

Anti-Plectin Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
FLVCR2 siRNA (Human)
MBS8203841-01 15 nmol

FLVCR2 siRNA (Human)

Sign In for Pricing
View Details
FLVCR2 siRNA (Human)
MBS8203841-02 30 nmol

FLVCR2 siRNA (Human)

Sign In for Pricing
View Details
FLVCR2 siRNA (Human)
MBS8203841-03 5x 30 nmol

FLVCR2 siRNA (Human)

Sign In for Pricing
View Details