Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STMN3 Peptide - middle region

STMN3 Peptide - middle region

Product Specifications

Product Name Alternative

SCLIP

UniProt

Q9NZ72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001263239.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EERRKTQEAQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SOD2 Monoclonal Antibody
AN300260P 100 µL

Recombinant SOD2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (His Tag)
PDMH100326-01 20 µg

Recombinant Human SPARC Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (His Tag)
PDMH100326-02 100 µg

Recombinant Human SPARC Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (His Tag)
PDMH100326-03 500 µg

Recombinant Human SPARC Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (His Tag)
PDMH100326-04 1 mg

Recombinant Human SPARC Protein (His Tag)

Sign In for Pricing
View Details
Bicyclopyrone
TRC-B382100-25MG 25 mg

Bicyclopyrone

Sign In for Pricing
View Details