Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STMN3 Peptide - middle region

STMN3 Peptide - middle region

Product Specifications

Product Name Alternative

SCLIP

UniProt

Q9NZ72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001263239.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EERRKTQEAQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Endometrium
CR559605 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
1-Triacontylamine Hydrochloride
TRC-T767060-50MG 50 mg

1-Triacontylamine Hydrochloride

Sign In for Pricing
View Details
12 Lipoxygenase (ALOX12) Human Gene Knockout Kit (CRISPR)
KN210211RB 1 Kit

12 Lipoxygenase (ALOX12) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
O-Acetyl Mandelic Acid
TRC-A185963-500MG 500 mg

O-Acetyl Mandelic Acid

Sign In for Pricing
View Details
Mupadolimab Biosimilar - Research Grade
ICH5136-5mg 5 mg

Mupadolimab Biosimilar - Research Grade

Sign In for Pricing
View Details
2-Bromobenzyl Bromide
TRC-B679975-5G 5 g

2-Bromobenzyl Bromide

Sign In for Pricing
View Details