Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMF1 Peptide - C-terminal region

PSMF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PI31

UniProt

Q92530

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006805.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cbl Mouse Gene Knockout Kit (CRISPR)
KN502595 1 Kit

Cbl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C9orf92 Human Gene Knockout Kit (CRISPR)
KN431657 1 Kit

C9orf92 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHRNA9 Rabbit Polyclonal Antibody
TA371739 100 µL

CHRNA9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLCN1 (NM_000083) Human Over-expression Lysate
LC424940 20 µg

CLCN1 (NM_000083) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MTRNR2L6 activation kit by CRISPRa
GA119267 1 Kit

Human MTRNR2L6 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Anisonitrile
TRC-A673935-5G 5 g

4-Anisonitrile

Sign In for Pricing
View Details