Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMF1 Peptide - C-terminal region

PSMF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PI31

UniProt

Q92530

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006805.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM120B Human Gene Knockout Kit (CRISPR)
KN414809 1 Kit

TMEM120B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE8B (NM_001029853) Human Over-expression Lysate
LC422472 20 µg

PDE8B (NM_001029853) Human Over-expression Lysate

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI9H8]
CF805497 100 µg

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI9H8]

Sign In for Pricing
View Details
Human GH Antibody Pair Set
E-KAB-0030 50 µL & 100 µg

Human GH Antibody Pair Set

Sign In for Pricing
View Details
(5-Chloro-2-nitrophenyl)(phenyl)carbamic Acid tert-Butyl Ester
TRC-C368545-250MG 250 mg

(5-Chloro-2-nitrophenyl)(phenyl)carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB08F2-PAG/W 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details