Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERL2 Peptide - C-terminal region

DERL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLANa, F-LANa, CGI-101, F-LAN-1, DERtrin-2

UniProt

Q9GZP9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001291708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(Dibutylamino)benzaldehyde
TRC-D462773-250MG 250 mg

4-(Dibutylamino)benzaldehyde

Sign In for Pricing
View Details
CD98 (SLC3A2) (NM_002394) Human Over-expression Lysate
LC429102 20 µg

CD98 (SLC3A2) (NM_002394) Human Over-expression Lysate

Sign In for Pricing
View Details
NAlpha-Acetyl-L-ornithine-d2
TRC-A187242-5MG 5 mg

NAlpha-Acetyl-L-ornithine-d2

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701844 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Fenproporex Hydrochloride
TRC-F249550-2.5MG 2.5 mg

Fenproporex Hydrochloride

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE,  15nm
GAF-005-15 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE, 15nm

Sign In for Pricing
View Details