Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERL2 Peptide - C-terminal region

DERL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLANa, F-LANa, CGI-101, F-LAN-1, DERtrin-2

UniProt

Q9GZP9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001291708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 810 acid
1385-AAT 1 mg

IFluor® 810 acid

Sign In for Pricing
View Details
MSC-GRO™ VitroPlus III Serum-Free Medium
PC00B3 500 mL

MSC-GRO™ VitroPlus III Serum-Free Medium

Sign In for Pricing
View Details
HB EGF (HBEGF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A4]
TA812463BM 100 µL

HB EGF (HBEGF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A4]

Sign In for Pricing
View Details
Human PGR (Progesterone Receptor) CLIA Kit
E-CL-H1337-01 24 Tests

Human PGR (Progesterone Receptor) CLIA Kit

Sign In for Pricing
View Details
Human PGR (Progesterone Receptor) CLIA Kit
E-CL-H1337-02 48 Tests

Human PGR (Progesterone Receptor) CLIA Kit

Sign In for Pricing
View Details
Human PGR (Progesterone Receptor) CLIA Kit
E-CL-H1337-03 96 Tests

Human PGR (Progesterone Receptor) CLIA Kit

Sign In for Pricing
View Details