Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRELD2 Peptide - middle region

CRELD2 Peptide - middle region

Product Specifications

UniProt

Q6UXH1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128573.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Danio rerio (Zebrafish) mdkb Antibody PE Conjugated
DZ41849-PE 200 µL/Vial

Anti-Danio rerio (Zebrafish) mdkb Antibody PE Conjugated

Sign In for Pricing
View Details
AGER, His, Cynomolgus
Z04726-100 100 µg

AGER, His, Cynomolgus

Sign In for Pricing
View Details
CD146 (Mucin 18, MUC18 Glycoprotein, Melanoma Associated Antigen A32, S-endo 1 Endothelial Associated Antigen, Melanoma Adhesion Molecule Mel-CM) (MaxLight 550)
C2548-78F-ML550 100 µL

CD146 (Mucin 18, MUC18 Glycoprotein, Melanoma Associated Antigen A32, S-endo 1 Endothelial Associated Antigen, Melanoma Adhesion Molecule Mel-CM) (MaxLight 550)

Sign In for Pricing
View Details
Anti-Salmonella A, B, D Antibody
18922 1 Each

Anti-Salmonella A, B, D Antibody

Sign In for Pricing
View Details
Cyclin D1 (bcl 1) (BSA & Azide Free) (MaxLight 550) discontinued
C8454-03X-ML550 100 µL

Cyclin D1 (bcl 1) (BSA & Azide Free) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-TNFRSF19 Antibody Picoband® Fluoro594 Conjugated
A06157-1-Fluoro594 100 µg/Vial

Anti-TNFRSF19 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details