Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPAP3 Peptide - middle region

RPAP3 Peptide - middle region

Product Specifications

UniProt

Q9H6T3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139547.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HESLSQESESEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-93-3p miRNA Antagomir
MNH03938 2x 5.0 nmol

hsa-miR-93-3p miRNA Antagomir

Sign In for Pricing
View Details
CYP2C70 siRNA (Rat)
MBS8231413-01 15 nmol

CYP2C70 siRNA (Rat)

Sign In for Pricing
View Details
CYP2C70 siRNA (Rat)
MBS8231413-02 30 nmol

CYP2C70 siRNA (Rat)

Sign In for Pricing
View Details
CYP2C70 siRNA (Rat)
MBS8231413-03 5x 30 nmol

CYP2C70 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Mouse LSM domain-containing protein 1 (Lsmd1)
MBS1472166-01 0.02 mg (E-Coli)

Recombinant Mouse LSM domain-containing protein 1 (Lsmd1)

Sign In for Pricing
View Details
Recombinant Mouse LSM domain-containing protein 1 (Lsmd1)
MBS1472166-02 0.1 mg (E-Coli)

Recombinant Mouse LSM domain-containing protein 1 (Lsmd1)

Sign In for Pricing
View Details