Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIT2 Peptide - middle region

RIT2 Peptide - middle region

Product Specifications

Product Name Alternative

RIN, RIBA, ROC2

UniProt

Q92963

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001259006.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC36A1 Antibody Picoband® Fluoro488 Conjugated
A05386-1-Fluoro488 100 µg/Vial

Anti-SLC36A1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Podoplanin Rabbit mAb
orb1924074-01 50 µL

Podoplanin Rabbit mAb

Sign In for Pricing
View Details
Podoplanin Rabbit mAb
orb1924074-02 100 µL

Podoplanin Rabbit mAb

Sign In for Pricing
View Details
R 3.5/1 on 300 copper mesh
orb2646460 100 PCS

R 3.5/1 on 300 copper mesh

Sign In for Pricing
View Details
ER alpha(Phospho Ser104) Polyclonal Antibody
JOT-AP08986-01 20 µL

ER alpha(Phospho Ser104) Polyclonal Antibody

Sign In for Pricing
View Details
ER alpha(Phospho Ser104) Polyclonal Antibody
JOT-AP08986-02 50 μL

ER alpha(Phospho Ser104) Polyclonal Antibody

Sign In for Pricing
View Details