What is the catalog number for CCT6A Peptide - middle region?

The catalog number for CCT6A Peptide - middle region is orb1999139.

What sizes are available for CCT6A Peptide - middle region?

CCT6A Peptide - middle region is available in the following size(s): 100 µg.

Is CCT6A Peptide - middle region in stock?

CCT6A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CCT6A Peptide - middle region

Product Specifications

Product Name Alternative

CCT6, Cctz, HTR3, TCPZ, TCP20, MoDP-2, TTCP20, CCT-zeta, CCT-zeta-1, TCP-1-zeta

UniProt

P40227

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009186.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSB-PA634265 100 µL

COL11A2 Antibody

Sign In for Pricing

View Details

NBP3-14047R 0.1 mL

Mouse Monoclonal ZC3H7A Antibody (PCRP-ZC3H7A-1D6) [DyLight 550]

Sign In for Pricing

View Details

12405164 1.0 µg

Arl9 AAV siRNA Pooled Vector

Sign In for Pricing

View Details

orb1323369-01 30 µL

ADH1B Antibody

Sign In for Pricing

View Details

orb1323369-02 50 μL

ADH1B Antibody

Sign In for Pricing

View Details

orb1323369-03 100 µL

ADH1B Antibody

Sign In for Pricing

View Details