Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6A Peptide - middle region

CCT6A Peptide - middle region

Product Specifications

Product Name Alternative

CCT6, Cctz, HTR3, TCPZ, TCP20, MoDP-2, TTCP20, CCT-zeta, CCT-zeta-1, TCP-1-zeta

UniProt

P40227

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009186.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS16 3'UTR GFP Stable Cell Line
TU073037 1.0 mL

SFRS16 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Serpina3k (BC011217) Mouse Untagged Clone
MC201055 10 µg

Serpina3k (BC011217) Mouse Untagged Clone

Sign In for Pricing
View Details
Photomedin-2 Antibody
MBS8513196-01 0.05 mg

Photomedin-2 Antibody

Sign In for Pricing
View Details
Photomedin-2 Antibody
MBS8513196-02 0.1 mg

Photomedin-2 Antibody

Sign In for Pricing
View Details
Photomedin-2 Antibody
MBS8513196-03 0.1 mL (AF750)

Photomedin-2 Antibody

Sign In for Pricing
View Details
Photomedin-2 Antibody
MBS8513196-04 0.1 mL (AF405M)

Photomedin-2 Antibody

Sign In for Pricing
View Details