Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM162A Peptide - middle region

FAM162A Peptide - middle region

Product Specifications

Product Name Alternative

E2IG5, HGTD-P, C3orf28

UniProt

Q96A26

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055182.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Large Capacity Pipette BPIP-600
BPIP-600 1 Unit

Large Capacity Pipette BPIP-600

Sign In for Pricing
View Details
Mouse Col4a2 activation kit by CRISPRa
GA200815 1 Kit

Mouse Col4a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human DCDC2 activation kit by CRISPRa
GA109823 1 Kit

Human DCDC2 activation kit by CRISPRa

Sign In for Pricing
View Details
(5Z)-5-Dodecenoic Acid
TRC-D535350-250MG 250 mg

(5Z)-5-Dodecenoic Acid

Sign In for Pricing
View Details
High frequency desktop ultrasonic Cleaner BULC-506
BULC-506 Each

High frequency desktop ultrasonic Cleaner BULC-506

Sign In for Pricing
View Details
Rbp7 (NM_022020) Mouse Tagged ORF Clone
MG200800 10 µg

Rbp7 (NM_022020) Mouse Tagged ORF Clone

Sign In for Pricing
View Details