Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC42EP3 Peptide - middle region

CDC42EP3 Peptide - middle region

Product Specifications

Product Name Alternative

UB1, CEP3, BORG2

UniProt

Q9UKI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257365.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERF105 Antibody
orb787883 2 mg

ERF105 Antibody

Sign In for Pricing
View Details
RPL21P2 AAV Vector (Human) (CMV)
41020101 1 µg

RPL21P2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PUS7L (NM_031292) Human Over-expression Lysate
E45H12497-2 20 µg

PUS7L (NM_031292) Human Over-expression Lysate

Sign In for Pricing
View Details
DEPDC5 CRISPRa sgRNA lentivector (set of three targets)(Human)
18032121 3x 1.0µg DNA

DEPDC5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human Transcription factor 7 (TCF7) ELISA kit
SLD3986Hu-01 96 Tests

Human Transcription factor 7 (TCF7) ELISA kit

Sign In for Pricing
View Details
Human Transcription factor 7 (TCF7) ELISA kit
SLD3986Hu-02 48 Tests

Human Transcription factor 7 (TCF7) ELISA kit

Sign In for Pricing
View Details