Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB6 Peptide - C-terminal region

TUBB6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TUBB-5, HsT1601

UniProt

Q9BUF5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001290453.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDATANDGEEAFEDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF740 conjugate, 0.1mg/mL
BNC741948-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL
BNC042641-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details