Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STBD1 Peptide - C-terminal region

STBD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GENEX3414, GENX-3414

UniProt

O95210

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003934.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM50A siRNA
abx916342-01 15 nmol

Human FAM50A siRNA

Sign In for Pricing
View Details
Human FAM50A siRNA
abx916342-02 30 nmol

Human FAM50A siRNA

Sign In for Pricing
View Details
Mouse Resistin (Retn) ELISA Kit
YLA0743MO-01 48 Tests

Mouse Resistin (Retn) ELISA Kit

Sign In for Pricing
View Details
Mouse Resistin (Retn) ELISA Kit
YLA0743MO-02 96 Tests

Mouse Resistin (Retn) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal HNF-6/ONECUT1 Antibody
NBP2-99314-100ul 100 µL

Rabbit Polyclonal HNF-6/ONECUT1 Antibody

Sign In for Pricing
View Details
RpsQ Antibody
orb828532 2 mg

RpsQ Antibody

Sign In for Pricing
View Details