STBD1 Peptide - C-terminal region
STBD1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GENEX3414, GENX-3414
UniProt
O95210
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003934.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR225263L3V 200 µL
Trpc3 (NM_019510) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
27981124 3x 1.0µg DNA
Man1a CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details 
