Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R2 Peptide - middle region

PPP1R2 Peptide - middle region

Product Specifications

Product Name Alternative

IPP2, IPP-2

UniProt

P41236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001303254.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppia (NM_008907) Mouse Tagged ORF Clone
MG201314 10 µg

Ppia (NM_008907) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Electrolyte Analyzer BANA-204
BANA-204 Each

Electrolyte Analyzer BANA-204

Sign In for Pricing
View Details
NOL12 Polyclonal Antibody
E-AB-64973-01 60 µL

NOL12 Polyclonal Antibody

Sign In for Pricing
View Details
NOL12 Polyclonal Antibody
E-AB-64973-02 120 µL

NOL12 Polyclonal Antibody

Sign In for Pricing
View Details
NOL12 Polyclonal Antibody
E-AB-64973-03 200 µL

NOL12 Polyclonal Antibody

Sign In for Pricing
View Details
ZADH1 Antibody
8C19633-AAT 50 µg

ZADH1 Antibody

Sign In for Pricing
View Details