Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R2 Peptide - middle region

PPP1R2 Peptide - middle region

Product Specifications

Product Name Alternative

IPP2, IPP-2

UniProt

P41236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001303254.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFP2 (TRIM13) (NM_213590) Human Recombinant Protein
TP309480 20 µg

RFP2 (TRIM13) (NM_213590) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Cullin-1 Antibody
RC-15156-01 50 μL

Recombinant Cullin-1 Antibody

Sign In for Pricing
View Details
Recombinant Cullin-1 Antibody
RC-15156-02 100 µL

Recombinant Cullin-1 Antibody

Sign In for Pricing
View Details
Recombinant Cullin-1 Antibody
RC-15156-03 1 mL

Recombinant Cullin-1 Antibody

Sign In for Pricing
View Details
Bcl2a1a Mouse Gene Knockout Kit (CRISPR)
KN502097 1 Kit

Bcl2a1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLASP1 Human Knockdown Lysate
LY300112 100 µg

CLASP1 Human Knockdown Lysate

Sign In for Pricing
View Details