NSUN5 Peptide - middle region
NSUN5 Peptide - middle region
Product Specifications
Product Name Alternative
NOL1, p120, NOL1R, NSUN5A, WBSCR20, WBSCR20A, p120 (NOL1)
UniProt
Q96P11
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001161819.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
244144-ML550 100 µL
CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit, CACNLB2, CAVB2, FLJ23743, MYSB) (MaxLight 550)
Sign In for Pricing
View Details MBS7223644-01 48 Well
Chicken Fibronectin type-III domain-containing protein C4orf31 (C4orf31) ELISA Kit
Sign In for Pricing
View Details MBS7223644-02 96 Well
Chicken Fibronectin type-III domain-containing protein C4orf31 (C4orf31) ELISA Kit
Sign In for Pricing
View Details MBS7223644-03 5x 96 Well
Chicken Fibronectin type-III domain-containing protein C4orf31 (C4orf31) ELISA Kit
Sign In for Pricing
View Details MBS7223644-04 10x 96 Well
Chicken Fibronectin type-III domain-containing protein C4orf31 (C4orf31) ELISA Kit
Sign In for Pricing
View Details 
ARP42875_P050 100 µL
Axin1 Antibody - N-terminal region (ARP42875_P050)
Sign In for Pricing
View Details