Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL6B Peptide - middle region

ACTL6B Peptide - middle region

Product Specifications

Product Name Alternative

ACTL6, BAF53B, arpNalpha

UniProt

O94805

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057272.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COLEC12 Antibody
KC-2036-01 50 μL

COLEC12 Antibody

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2036-02 100 µL

COLEC12 Antibody

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2036-03 1 mL

COLEC12 Antibody

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF647 conjugate, 0.1mg/mL
BNC471125-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast, left
CS651896 5x 5 µm

Frozen Tissue Sections, Breast, left

Sign In for Pricing
View Details
IKZF2 Antibody (Biotin)
KB-8003-01 50 μL

IKZF2 Antibody (Biotin)

Sign In for Pricing
View Details