Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL6B Peptide - middle region

ACTL6B Peptide - middle region

Product Specifications

Product Name Alternative

ACTL6, BAF53B, arpNalpha

UniProt

O94805

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057272.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF151 Human Gene Knockout Kit (CRISPR)
KN420873 1 Kit

RNF151 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vimentin (VM1170), CF647 conjugate, 0.1mg/mL
BNC471170-500 1x 500 µL

Vimentin (VM1170), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse BNP (Brain Natriuretic Peptide) ELISA Kit
E-EL-M0204-01 24 Tests

Mouse BNP (Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Mouse BNP (Brain Natriuretic Peptide) ELISA Kit
E-EL-M0204-02 48 Tests

Mouse BNP (Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Mouse BNP (Brain Natriuretic Peptide) ELISA Kit
E-EL-M0204-03 96 Tests

Mouse BNP (Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
LAMA3 (NM_001302996) Human Tagged ORF Clone
RG238518 10 µg

LAMA3 (NM_001302996) Human Tagged ORF Clone

Sign In for Pricing
View Details