PANK3 Peptide - middle region
PANK3 Peptide - middle region
Product Specifications
UniProt
Q9BZ23
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_078870.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLDDPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45H38494M5 20 µg
CTRP4 (C1QTNF4) (NM_031909) Human Recombinant Protein
Sign In for Pricing
View Details 
OR1061979-01 100 mg
2- (4- (tert-Butyl) thiazol-2 (5H) -ylidene) malononitrile
Sign In for Pricing
View Details OR1061979-02 250 mg
2- (4- (tert-Butyl) thiazol-2 (5H) -ylidene) malononitrile
Sign In for Pricing
View Details 
486538 100 µL
NAPRT1 (Nicotinate Phosphoribosyltransferase, Nicotinate Phosphoribosyltransferase Domain Containing 1)
Sign In for Pricing
View Details