Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK3 Peptide - middle region

PANK3 Peptide - middle region

Product Specifications

UniProt

Q9BZ23

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078870.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLDDPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA4
486673 100 µL

NDUFA4

Sign In for Pricing
View Details
Recombinant Human TF protein (Not iron-free), Fc-tag, GMP Grade
TF-543THP 10 µg

Recombinant Human TF protein (Not iron-free), Fc-tag, GMP Grade

Sign In for Pricing
View Details
DYNC2LI1 (H-4) Alexa Fluor® 594
sc-376644 AF594 200 µg/mL

DYNC2LI1 (H-4) Alexa Fluor® 594

Sign In for Pricing
View Details
Rat Monoclonal anti-mouse S100A4
mAP-0522 50 µg

Rat Monoclonal anti-mouse S100A4

Sign In for Pricing
View Details
RPL37 AAV siRNA Pooled Vector
41606161 1.0 µg

RPL37 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human Monoclonal FOLR1 Antibody (Dompe patent anti-FOLR1) [Janelia Fluor 635]
NBP3-28044JF635 0.1 mL

Human Monoclonal FOLR1 Antibody (Dompe patent anti-FOLR1) [Janelia Fluor 635]

Sign In for Pricing
View Details