Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSH3 Peptide - middle region

SSH3 Peptide - middle region

Product Specifications

Product Name Alternative

SSH3L

UniProt

Q8TE77

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060327.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLGLVLPLWSDTQVYLDGDGGFSVTSGGQSRIFKPISIQTMWATLQVLHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bladder invasive urothelial carcinoma with matched bladder tissue array, including pathology grade, TNM and clinical stage, 12 cases/24 cores(1.5mm), replacing BL244a
BL244b 1 Each

Bladder invasive urothelial carcinoma with matched bladder tissue array, including pathology grade, TNM and clinical stage, 12 cases/24 cores(1.5mm), replacing BL244a

Sign In for Pricing
View Details
2-Phenylpropionic acid
C11804 25 µL

2-Phenylpropionic acid

Sign In for Pricing
View Details
HCV NS3 recombinant antigen a.a 1400 to a.a 1643 of HCV polyprotein 22 kDa
MBS485146-01 0.1 mg

HCV NS3 recombinant antigen a.a 1400 to a.a 1643 of HCV polyprotein 22 kDa

Sign In for Pricing
View Details
HCV NS3 recombinant antigen a.a 1400 to a.a 1643 of HCV polyprotein 22 kDa
MBS485146-02 1 mg

HCV NS3 recombinant antigen a.a 1400 to a.a 1643 of HCV polyprotein 22 kDa

Sign In for Pricing
View Details
HCV NS3 recombinant antigen a.a 1400 to a.a 1643 of HCV polyprotein 22 kDa
MBS485146-03 5x 1 mg

HCV NS3 recombinant antigen a.a 1400 to a.a 1643 of HCV polyprotein 22 kDa

Sign In for Pricing
View Details
UBA1, NT (UBA1, A1S9T, UBE1, Ubiquitin-like modifier-activating enzyme 1, Protein A1S9, Ubiquitin-activating enzyme E1) (Azide free) (HRP)
MBS6360523-01 0.2 mL

UBA1, NT (UBA1, A1S9T, UBE1, Ubiquitin-like modifier-activating enzyme 1, Protein A1S9, Ubiquitin-activating enzyme E1) (Azide free) (HRP)

Sign In for Pricing
View Details