Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSH3 Peptide - middle region

SSH3 Peptide - middle region

Product Specifications

Product Name Alternative

SSH3L

UniProt

Q8TE77

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060327.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLGLVLPLWSDTQVYLDGDGGFSVTSGGQSRIFKPISIQTMWATLQVLHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB2 (CD18, MFI7, Integrin beta-2, Cell Surface Adhesion Glycoproteins LFA-1/CR3/p150,95 Subunit beta, Complement Receptor C3 Subunit beta) (MaxLight 550)
128637-ML550 100 µL

ITGB2 (CD18, MFI7, Integrin beta-2, Cell Surface Adhesion Glycoproteins LFA-1/CR3/p150,95 Subunit beta, Complement Receptor C3 Subunit beta) (MaxLight 550)

Sign In for Pricing
View Details
Tie-2, phosphorylated (Y992) discontinued
340834-01 100 µL

Tie-2, phosphorylated (Y992) discontinued

Sign In for Pricing
View Details
Tie-2, phosphorylated (Y992) discontinued
340834-02 200 µL

Tie-2, phosphorylated (Y992) discontinued

Sign In for Pricing
View Details
NUMB siRNA (Human)
orb1862570-01 15 nmol

NUMB siRNA (Human)

Sign In for Pricing
View Details
NUMB siRNA (Human)
orb1862570-02 30 nmol

NUMB siRNA (Human)

Sign In for Pricing
View Details
CD44 Human Monoclonal Antibody (PE)
orb2970994-01 50 Tests

CD44 Human Monoclonal Antibody (PE)

Sign In for Pricing
View Details