Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB1 Peptide - middle region

SNTB1 Peptide - middle region

Product Specifications

Product Name Alternative

A1B, SNT2, BSYN2, 59-DAP, DAPA1B, SNT2B1, TIP-43

UniProt

Q13884

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066301.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YVTRSMALADPENRQLEIHSPDAKHTVILRSKDSATAQAWFSAIHSNVND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Epiursolic Acid (Standard)
HY-N4289R 1 Each

3-Epiursolic Acid (Standard)

Sign In for Pricing
View Details
60 kDa Chaperonin (groL) Antibody
abx300261-01 20 µg

60 kDa Chaperonin (groL) Antibody

Sign In for Pricing
View Details
60 kDa Chaperonin (groL) Antibody
abx300261-02 50 µg

60 kDa Chaperonin (groL) Antibody

Sign In for Pricing
View Details
60 kDa Chaperonin (groL) Antibody
abx300261-03 100 µg

60 kDa Chaperonin (groL) Antibody

Sign In for Pricing
View Details
60 kDa Chaperonin (groL) Antibody
abx300261-04 200 µg

60 kDa Chaperonin (groL) Antibody

Sign In for Pricing
View Details
60 kDa Chaperonin (groL) Antibody
abx300261-05 1 mg

60 kDa Chaperonin (groL) Antibody

Sign In for Pricing
View Details