Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KYAT1 Peptide - middle region

KYAT1 Peptide - middle region

Product Specifications

Product Name Alternative

GTK, KAT1, KATI, CCBL1

UniProt

Q16773

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116143.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NCR1/NKp46 Recombinant Rabbit monoclonal Antibody
HA725322B 100 µL

Human NCR1/NKp46 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF488A conjugate, 0.1mg/mL
BNC881474-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sambucus Nigra Lectin (SNA, EBL), Biotin Conjugate
#29120 1x 1 mL

Sambucus Nigra Lectin (SNA, EBL), Biotin Conjugate

Sign In for Pricing
View Details
Human DEPDC1B activation kit by CRISPRa
GA110971 1 Kit

Human DEPDC1B activation kit by CRISPRa

Sign In for Pricing
View Details
CBX8 Rabbit Polyclonal Antibody
TA374330 100 µL

CBX8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Epsin 2 (EPN2) (NM_001102664) Human Over-expression Lysate
LY420185 100 µg

Epsin 2 (EPN2) (NM_001102664) Human Over-expression Lysate

Sign In for Pricing
View Details