Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KYAT1 Peptide - middle region

KYAT1 Peptide - middle region

Product Specifications

Product Name Alternative

GTK, KAT1, KATI, CCBL1

UniProt

Q16773

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116143.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

12-Bromo-1-aminododecane, Hydrobromide
TRC-B679575-25MG 25 mg

12-Bromo-1-aminododecane, Hydrobromide

Sign In for Pricing
View Details
Armh3 Mouse Gene Knockout Kit (CRISPR)
KN500507 1 Kit

Armh3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Usp17ld Mouse Gene Knockout Kit (CRISPR)
KN518775 1 Kit

Usp17ld Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Clint1 Mouse Gene Knockout Kit (CRISPR)
KN503464 1 Kit

Clint1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF640R conjugate, 0.1mg/mL
BNC402409-100 1x 100 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PEDF Antibody
RC-15797-01 50 μL

Recombinant PEDF Antibody

Sign In for Pricing
View Details