Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK2 Peptide - middle region

GALK2 Peptide - middle region

Product Specifications

Product Name Alternative

GK2

UniProt

Q01415

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001556.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Myelin proteolipid protein (PLP1)
MBS7026288-01 0.02 mg

Recombinant Bovine Myelin proteolipid protein (PLP1)

Sign In for Pricing
View Details
Recombinant Bovine Myelin proteolipid protein (PLP1)
MBS7026288-02 0.1 mg

Recombinant Bovine Myelin proteolipid protein (PLP1)

Sign In for Pricing
View Details
Recombinant Bovine Myelin proteolipid protein (PLP1)
MBS7026288-03 5x 0.1 mg

Recombinant Bovine Myelin proteolipid protein (PLP1)

Sign In for Pricing
View Details
FITC-Labeled NCAM-1/CD56, Human (HEK293, His)
HY-P78648 1 Each

FITC-Labeled NCAM-1/CD56, Human (HEK293, His)

Sign In for Pricing
View Details
SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (MaxLight 490)
MBS6204963-01 0.1 mL

SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (MaxLight 490)

Sign In for Pricing
View Details
SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (MaxLight 490)
MBS6204963-02 5x 0.1 mL

SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (MaxLight 490)

Sign In for Pricing
View Details