Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK2 Peptide - middle region

GALK2 Peptide - middle region

Product Specifications

Product Name Alternative

GK2

UniProt

Q01415

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001556.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p27Kip1 (T198) Antibody
orb1931124-01 50 µL

Phospho-p27Kip1 (T198) Antibody

Sign In for Pricing
View Details
Phospho-p27Kip1 (T198) Antibody
orb1931124-02 100 µL

Phospho-p27Kip1 (T198) Antibody

Sign In for Pricing
View Details
IGSF9 siRNA (Human)
CRJ1528-01 15 nmol

IGSF9 siRNA (Human)

Sign In for Pricing
View Details
IGSF9 siRNA (Human)
CRJ1528-02 30 nmol

IGSF9 siRNA (Human)

Sign In for Pricing
View Details
NDUFA9 ORF Vector (Human) (pORF)
ORF006984 1.0 µg DNA

NDUFA9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-HEXA Antibody Picoband®, Cy3 Conjugate
PA1787-Cy3 100 µg/Vial

Anti-HEXA Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details