Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM57A Peptide - middle region

FAM57A Peptide - middle region

Product Specifications

Product Name Alternative

CT120

UniProt

Q8TBR7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELSTPFVSLGRVLIQLKQQHTLLYKVNGILTLATFLSCRILLFPFMYWSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spred3 Mouse Gene Knockout Kit (CRISPR)
KN516652 1 Kit

Spred3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS703498 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
AZI2 Antibody
8C11698-AAT 50 µg

AZI2 Antibody

Sign In for Pricing
View Details
Moricizine
TRC-M635025-10MG 10 mg

Moricizine

Sign In for Pricing
View Details
5-Ethynyl Nicotine
TRC-E932200-1MG 1 mg

5-Ethynyl Nicotine

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF488A conjugate, 0.1mg/mL
BNC881897-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details