Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM57A Peptide - middle region

FAM57A Peptide - middle region

Product Specifications

Product Name Alternative

CT120

UniProt

Q8TBR7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELSTPFVSLGRVLIQLKQQHTLLYKVNGILTLATFLSCRILLFPFMYWSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutathione Peroxidase 3, Plasma (GPX3) ELISA Kit
RDR-GPX3-Hu-01 96 Tests

Human Glutathione Peroxidase 3, Plasma (GPX3) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione Peroxidase 3, Plasma (GPX3) ELISA Kit
RDR-GPX3-Hu-02 48 Tests

Human Glutathione Peroxidase 3, Plasma (GPX3) ELISA Kit

Sign In for Pricing
View Details
TrueBlack® WB Blocking Buffer Kit (Trial Size)
#23013-T 1 Kit

TrueBlack® WB Blocking Buffer Kit (Trial Size)

Sign In for Pricing
View Details
Gliftor
TRC-G410000-250MG 250 mg

Gliftor

Sign In for Pricing
View Details
NF1 Antibody
KC-8446-01 50 μL

NF1 Antibody

Sign In for Pricing
View Details
NF1 Antibody
KC-8446-02 100 µL

NF1 Antibody

Sign In for Pricing
View Details