What is the catalog number for PELI2 Peptide - N-terminal region?

The catalog number for PELI2 Peptide - N-terminal region is orb1999111.

What sizes are available for PELI2 Peptide - N-terminal region?

PELI2 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is PELI2 Peptide - N-terminal region in stock?

PELI2 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PELI2 Peptide - N-terminal region

Product Specifications

UniProt

Q9HAT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067078.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-409816-NIC 20 µg

SP140 Double Nickase Plasmid (h)

Sign In for Pricing

View Details

MBS6146440-01 0.1 mL

CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) (FITC)

Sign In for Pricing

View Details

MBS6146440-02 5x 0.1 mL

CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) (FITC)

Sign In for Pricing

View Details

E45R09241G-1 100 µL

Phospho-TSC1 (S598) Antibody

Sign In for Pricing

View Details

E3375-11T1-Biotin 200 µL

EGFR (S1070) (Epidermal Growth Factor Receptor, Receptor Tyrosine-protein Kinase ErbB-1, Proto-oncogene c-ErbB-1, ERBB1) (Biotin) discontinued

Sign In for Pricing

View Details

GK7040-1l 1 L

Heptane, technical grade

Sign In for Pricing

View Details