Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PELI2 Peptide - N-terminal region

PELI2 Peptide - N-terminal region

Product Specifications

UniProt

Q9HAT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067078.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ChoKB HDR Plasmid (m)
sc-419646-HDR 20 µg

ChoKB HDR Plasmid (m)

Sign In for Pricing
View Details
ATP6V1C2 Knockout Hela Polyclonal Cells
ARG20967 1 Million

ATP6V1C2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
BTNL9 Antibody - N-terminal region : FITC (ARP53034_P050-FITC)
ARP53034_P050-FITC 100 µL

BTNL9 Antibody - N-terminal region : FITC (ARP53034_P050-FITC)

Sign In for Pricing
View Details
Polyclonal Antibody to Gastrokine 3 (GKN3)
TRV-0036709-01 20 µL

Polyclonal Antibody to Gastrokine 3 (GKN3)

Sign In for Pricing
View Details
Polyclonal Antibody to Gastrokine 3 (GKN3)
TRV-0036709-02 100 µL

Polyclonal Antibody to Gastrokine 3 (GKN3)

Sign In for Pricing
View Details
Polyclonal Antibody to Gastrokine 3 (GKN3)
TRV-0036709-03 200 µL

Polyclonal Antibody to Gastrokine 3 (GKN3)

Sign In for Pricing
View Details