What is the catalog number for HAUS3 Peptide - middle region?

The catalog number for HAUS3 Peptide - middle region is orb1999108.

What sizes are available for HAUS3 Peptide - middle region?

HAUS3 Peptide - middle region is available in the following size(s): 100 µg.

Is HAUS3 Peptide - middle region in stock?

HAUS3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HAUS3 Peptide - middle region

Product Specifications

Product Name Alternative

IT1, dgt3, C4orf15

UniProt

Q68CZ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001290072.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

48682-01 50 µL

MEK1 Antibody

Sign In for Pricing

View Details

48682-02 100 µL

MEK1 Antibody

Sign In for Pricing

View Details

22752022 500 ng

GSTK1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing

View Details

RC208134L3 10 µg

Mannose Phosphate Isomerase (MPI) (NM_002435) Human Tagged Lenti ORF Clone

Sign In for Pricing

View Details

MBS2506870-01 24 Tests

Chicken beta-TG (beta-Thromboglobulin) ELISA Kit

Sign In for Pricing

View Details

MBS2506870-02 48 Tests

Chicken beta-TG (beta-Thromboglobulin) ELISA Kit

Sign In for Pricing

View Details