HAUS3 Peptide - middle region
HAUS3 Peptide - middle region
Product Specifications
Product Name Alternative
IT1, dgt3, C4orf15
UniProt
Q68CZ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001290072.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H00051122-P01-10ug 10 µg
Recombinant Human COMMD2 Protein - (Dry Ice)
Sign In for Pricing
View Details 
CPB-626RH 100 ul
Rabbit Anti-Human AKT1 Polyclonal Antibody, Phospho-Tyr308
Sign In for Pricing
View Details 131389-ML550 100 µL
PKD2L1 (Polycystic Kidney Disease 2-like 1 Protein, Polycystin-2 Homolog, Polycystin-2L1, Polycystin-L, Polycystin-L1, PKD2L, PKDL, TRPP3) (MaxLight 550)
Sign In for Pricing
View Details