DDX18 Peptide - C-terminal region
DDX18 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MrDb
UniProt
Q9NVP1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006764.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VALSFGFKVPPFVDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN200368RB 1 Kit
elF2 alpha (EIF2S1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
MBS6394606-01 0.1 mL
SNCG (Gamma-synuclein, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, BCSG1, PERSYN, PRSN) (MaxLight 750)
Sign In for Pricing
View Details MBS6394606-02 5x 0.1 mL
SNCG (Gamma-synuclein, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, BCSG1, PERSYN, PRSN) (MaxLight 750)
Sign In for Pricing
View Details MBS1094847-01 0.02 mg (E-Coli)
Recombinant Gramella forsetii Dihydrodipicolinate reductase (dapB)
Sign In for Pricing
View Details MBS1094847-02 0.1 mg (E-Coli)
Recombinant Gramella forsetii Dihydrodipicolinate reductase (dapB)
Sign In for Pricing
View Details MBS1094847-03 0.02 mg (Yeast)
Recombinant Gramella forsetii Dihydrodipicolinate reductase (dapB)
Sign In for Pricing
View Details