PITPNA Peptide - middle region
PITPNA Peptide - middle region
Product Specifications
Product Name Alternative
PITPN, VIB1A, HEL-S-36, PI-TPalpha
UniProt
P48739
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006215.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx502031 96 Tests
Mouse AP-3 complex subunit beta-2 (AP3B2) ELISA Kit
Sign In for Pricing
View Details 
814034 250 Roll (250 Label (s) x 1 Roll)
PIC 1803-50*50-B7541-RLL-DC Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
Sign In for Pricing
View Details 
MBS2058771-01 0.1 mL
PE-Linked Polyclonal Antibody to Oncostatin M Receptor (OSMR)
Sign In for Pricing
View Details MBS2058771-02 0.2 mL
PE-Linked Polyclonal Antibody to Oncostatin M Receptor (OSMR)
Sign In for Pricing
View Details