Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNA Peptide - middle region

PITPNA Peptide - middle region

Product Specifications

Product Name Alternative

PITPN, VIB1A, HEL-S-36, PI-TPalpha

UniProt

P48739

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006215.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP26B1 Double Nickase Plasmid (m2)
sc-433142-NIC-2 20 µg

CYP26B1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Mouse SELPLG protein
orb392432-01 10 µg

Mouse SELPLG protein

Sign In for Pricing
View Details
Mouse SELPLG protein
orb392432-02 50 µg

Mouse SELPLG protein

Sign In for Pricing
View Details
Mouse SELPLG protein
orb392432-03 500 µg

Mouse SELPLG protein

Sign In for Pricing
View Details
Protein argonaute-3 (EIF2C3) Mouse ELISA Kit
G2415 96 Tests

Protein argonaute-3 (EIF2C3) Mouse ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TYRO3 protein, C-His tag
IMP-1264 10 µg

Recombinant Human TYRO3 protein, C-His tag

Sign In for Pricing
View Details