Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUAP1 Peptide - C-terminal region

CLUAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAP22, CFAP22

UniProt

Q96AJ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055856.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDSELEERRLPKPQTAMEMLMQGRPGKRIVGTMQGGDSDDNEDSEESEID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC3 (NM_001100118) Human Over-expression Lysate
LY420223 100 µg

XRCC3 (NM_001100118) Human Over-expression Lysate

Sign In for Pricing
View Details
PIG3 (TP53I3) (1-332) Mouse Monoclonal Antibody [Clone ID: AT1C9]
AM50012PU-S 50 µL

PIG3 (TP53I3) (1-332) Mouse Monoclonal Antibody [Clone ID: AT1C9]

Sign In for Pricing
View Details
Phospho-Cdk2 (Y15) Recombinant Rabbit monoclonal Antibody
HA750260 100 µL

Phospho-Cdk2 (Y15) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TBC1D26 (NM_178571) Human Recombinant Protein
TP308210L 1 mg

TBC1D26 (NM_178571) Human Recombinant Protein

Sign In for Pricing
View Details
Srebf1 Mouse Gene Knockout Kit (CRISPR)
KN516704 1 Kit

Srebf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cma2 Mouse Gene Knockout Kit (CRISPR)
KN503507 1 Kit

Cma2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details