Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUAP1 Peptide - C-terminal region

CLUAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAP22, CFAP22

UniProt

Q96AJ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055856.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDSELEERRLPKPQTAMEMLMQGRPGKRIVGTMQGGDSDDNEDSEESEID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UVRAG (389-699) Mouse Monoclonal Antibody [Clone ID: 1H4]
AM26654AF-N 100 µg

UVRAG (389-699) Mouse Monoclonal Antibody [Clone ID: 1H4]

Sign In for Pricing
View Details
Commd10 (NM_178377) Mouse Tagged ORF Clone
MG202092 10 µg

Commd10 (NM_178377) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MSX2 Antibody
OC-495-01 50 μL

MSX2 Antibody

Sign In for Pricing
View Details
MSX2 Antibody
OC-495-02 100 µL

MSX2 Antibody

Sign In for Pricing
View Details
MSX2 Antibody
OC-495-03 1 mL

MSX2 Antibody

Sign In for Pricing
View Details
PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016F-01 20 Tests

PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details