What is the catalog number for UPK3B Peptide - middle region?

The catalog number for UPK3B Peptide - middle region is orb1999102.

What sizes are available for UPK3B Peptide - middle region?

UPK3B Peptide - middle region is available in the following size(s): 100 µg.

Is UPK3B Peptide - middle region in stock?

UPK3B Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

UPK3B Peptide - middle region

Product Specifications

Product Name Alternative

P35, UP3B, UPIIIB

UniProt

Q9BT76

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_085047.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLASASDTVWLVVAFSNASRGFQNPETLADIPASPQLLTDGHYMTLPLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MR214812 10 µg

Tex28 (NM_001126488) Mouse Tagged ORF Clone

Sign In for Pricing

View Details

17503101 1 µg

CYP4F31P AAV Vector (Human) (CMV)

Sign In for Pricing

View Details

PV143354 500 ng

VWA1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing

View Details

AAP78919-100UG 100 µg

CD19 Peptide - C-terminal region (AAP78919)

Sign In for Pricing

View Details

abx538245 96 Tests

Mouse Polymerase Delta-Interacting Protein 3 (POLDIP3) ELISA Kit

Sign In for Pricing

View Details

VAng-Lsx07049-500gEcoli 500 µg (E. coli)

Recombinant Shigella Dysenteriae pdxY Protein (aa 1-287)

Sign In for Pricing

View Details