What is the catalog number for UPK3B Peptide - middle region?

The catalog number for UPK3B Peptide - middle region is orb1999102.

What sizes are available for UPK3B Peptide - middle region?

UPK3B Peptide - middle region is available in the following size(s): 100 µg.

Is UPK3B Peptide - middle region in stock?

UPK3B Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

UPK3B Peptide - middle region

Product Specifications

Product Name Alternative

P35, UP3B, UPIIIB

UniProt

Q9BT76

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_085047.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLASASDTVWLVVAFSNASRGFQNPETLADIPASPQLLTDGHYMTLPLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-73417V 0.1 mL

Mouse Monoclonal PIP5K2 alpha Antibody (OTI3D3) [DyLight 405]

Sign In for Pricing

View Details

BNC400966-100 1x 100 µL

Hepatocyte Specific (HepPar1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing

View Details

RC212140L4V 200 µL

HRH2 (NM_022304) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing

View Details

abx353393-01 96 Tests

Monkey Fibroblast Growth Factor 19 (FGF19) ELISA Kit

Sign In for Pricing

View Details

abx353393-02 5x 96 Tests

Monkey Fibroblast Growth Factor 19 (FGF19) ELISA Kit

Sign In for Pricing

View Details

abx353393-03 10x 96 Tests

Monkey Fibroblast Growth Factor 19 (FGF19) ELISA Kit

Sign In for Pricing

View Details