ENTPD6 Peptide - middle region
ENTPD6 Peptide - middle region
Product Specifications
Product Name Alternative
CD39L2, IL6ST2, IL-6SAG, NTPDase-6
UniProt
O75354
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001107561.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEKSAQGIRELL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
053997-01 10 µg
Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag
Sign In for Pricing
View Details 053997-02 50 µg
Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag
Sign In for Pricing
View Details 053997-03 100 µg
Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag
Sign In for Pricing
View Details 053997-04 200 µg
Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag
Sign In for Pricing
View Details 
sc-403473-LAC-2 200 µL
GPIHBP1 Lentiviral Activation Particles (h2)
Sign In for Pricing
View Details