ENTPD6 Peptide - middle region
ENTPD6 Peptide - middle region
Product Specifications
Product Name Alternative
CD39L2, IL6ST2, IL-6SAG, NTPDase-6
UniProt
O75354
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001107561.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEKSAQGIRELL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
131806 100 µg
PRKCQ (Protein Kinase C theta Type, nPKC-theta, PRKCT, MGC126514, MGC141919)
Sign In for Pricing
View Details 
MR216567L4V 200 µL
Nkrf (NM_029891) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
GTR15176108 1 Vial
Lentiviral mouse Fastkd5 shRNA (UAS) - Lentiviral mouseFastkd5 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details