Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL12 Peptide - C-terminal region

TTLL12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ526I14.2

UniProt

Q14166

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055955.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKWDNGPDGRRVMQPQILEVNFNPDCERACRYHPTFFNDVFSTLFLDQPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS628953 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
PDE9A (NM_001001568) Human Over-expression Lysate
LC424385 20 µg

PDE9A (NM_001001568) Human Over-expression Lysate

Sign In for Pricing
View Details
C2cd5 Mouse Gene Knockout Kit (CRISPR)
KN502372 1 Kit

C2cd5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Bromo-5-iodobenzaldehyde
TRC-B679493-2.5G 2.5 g

2-Bromo-5-iodobenzaldehyde

Sign In for Pricing
View Details
TFAP4 (NM_003223) Human Over-expression Lysate
LY401113 100 µg

TFAP4 (NM_003223) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704426 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details