Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL12 Peptide - C-terminal region

TTLL12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ526I14.2

UniProt

Q14166

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055955.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKWDNGPDGRRVMQPQILEVNFNPDCERACRYHPTFFNDVFSTLFLDQPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nitrate Colorimetric Assay Kit
E-BC-K895-M 96 T (39 samples)

Nitrate Colorimetric Assay Kit

Sign In for Pricing
View Details
p75 NGF Receptor Recombinant Rabbit monoclonal Antibody [SA39-02]
ET1601-22-50UL 50 µL

p75 NGF Receptor Recombinant Rabbit monoclonal Antibody [SA39-02]

Sign In for Pricing
View Details
ACSL5 Mouse Monoclonal Antibody [Clone ID: OTI3A3]
CF811897 100 µg

ACSL5 Mouse Monoclonal Antibody [Clone ID: OTI3A3]

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF647 conjugate, 0.1mg/mL
BNC471497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cabyr Mouse Gene Knockout Kit (CRISPR)
KN502410 1 Kit

Cabyr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Butoxy-4-nitrobenzoic Acid
TRC-B922610-25MG 25 mg

3-Butoxy-4-nitrobenzoic Acid

Sign In for Pricing
View Details